PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010521380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 104aa    MW: 12688.2 Da    PI: 10.7251
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010521380.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.94.7e-083574445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++++E++l+++  ++ G + W++Ia +++ gR ++++  +w 
   XP_010521380.1 35 MSEQEEDLIYRMYRLVGDR-WDLIAGRIP-GRQAEEIERYWI 74
                     699**************99.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.4E-53179IPR001005SANT/Myb domain
CDDcd001678.99E-53473No hitNo description
PfamPF002491.7E-73574IPR001005SANT/Myb domain
PROSITE profilePS500906.1443673IPR017877Myb-like domain
SuperFamilySSF466894.37E-73674IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-93674IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MDNTNQQRRR RLKQPKSTFH ESEEVSSREW EFISMSEQEE DLIYRMYRLV GDRWDLIAGR  60
IPGRQAEEIE RYWIMRNSEG FAERRRQQRL KKKSSRGHAS SSRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010521380.11e-70PREDICTED: transcription factor TRY-like
SwissprotQ8GV056e-47TRY_ARATH; Transcription factor TRY
TrEMBLD7MSV56e-46D7MSV5_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_80013502e-45(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.12e-44MYB_related family protein